20% OFF shipping at www.goldebi.com on orders over $79 + up to 10% OFF products
www.goldebi.com
home > LL-37 > LL-37
download picture
LL-37LL 37: Pioneering Antimicrobial Peptide for Research Advance Your Immunology Studies with LL 37 LL 37, a cathelicidin derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies. LL 37 Specifications: Sequence: [LL-37, 37 aa] Molecular Weight: 4493. 33 g mol
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols
LL-37

LL-37

Item no : 98017188105
sold recently : Login >>
US$ 65.00
Pay in 4 interest-free payments of $16.25 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Enjoy 20% off shipping

US$ 65.00

1-11

US$ 58.50

12-35

US$ 45.50

36-59

US$ 39.00

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

Related Searches